Lineage for d2r93g1 (2r93 G:1-171)

  1. Root: SCOPe 2.06
  2. 2268314Class i: Low resolution protein structures [58117] (25 folds)
  3. 2270442Fold i.8: RNA polymerase [58180] (1 superfamily)
  4. 2270443Superfamily i.8.1: RNA polymerase [58181] (1 family) (S)
  5. 2270444Family i.8.1.1: RNA polymerase [58182] (2 proteins)
  6. 2270445Protein Complete 12-subunit RNA polymerase II complex [90261] (1 species)
  7. 2270446Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [90262] (23 PDB entries)
  8. 2270462Domain d2r93g1: 2r93 G:1-171 [151758]
    Other proteins in same PDB: d2r93b1, d2r93f1, d2r93h1, d2r93j1, d2r93l1
    automatically matched to d1wcmg_
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d2r93g1

PDB Entry: 2r93 (more details), 4 Å

PDB Description: elongation complex of rna polymerase ii with a hepatitis delta virus- derived rna stem loop
PDB Compounds: (G:) DNA-directed RNA polymerase II subunit RPB7

SCOPe Domain Sequences for d2r93g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r93g1 i.8.1.1 (G:1-171) Complete 12-subunit RNA polymerase II complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mffikdlslnitlhpsffgprmkqylktklleevegsctgkfgyilcvldydnidiqrgr
ilptdgsaefnvkyravvfkpfkgevvdgtvvscsqhgfevqvgpmkvfvtkhlmpqdlt
fnagsnppsyqssedvitiksrirvkiegcisqvssihaigsikedylgai

SCOPe Domain Coordinates for d2r93g1:

Click to download the PDB-style file with coordinates for d2r93g1.
(The format of our PDB-style files is described here.)

Timeline for d2r93g1: