Lineage for d1myia_ (1myi A:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies) Superfamily a.1.1: Globin-like [46458] (3 families) 
Family a.1.1.2: Globins [46463] (16 proteins) Protein Myoglobin [46469] (9 species) 
Species Pig (Sus scrofa) [TaxId:9823] [46473] (17 PDB entries) 
Domain d1myia_: 1myi A: [15175]
Details for d1myia_
PDB Entry: 1myi (more details), 2 Å
PDB Description: high resolution x-ray structures of pig metmyoglobin and two cd3 mutants mb(lys45-> arg) and mb(lys45-> ser)
SCOP Domain Sequences for d1myia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1myia_ a.1.1.2 (A:) Myoglobin {Pig (Sus scrofa)}
glsdgewqlvlnvwgkveadvaghgqevlirlfkghpetlekfdsfkhlksedemkased
lkkhgntvltalggilkkkghheaeltplaqshatkhkipvkylefiseaiiqvlqskhp
gdfgadaqgamskalelfrndmaakykelgfqg
SCOP Domain Coordinates for d1myia_:
Click to download the PDB-style file with coordinates for d1myia_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1myia_:
- d1myia_ appears in SCOP 1.57
- d1myia_ appears in the current release, SCOPe 2.08
View in 3D
