Lineage for d2r8pb1 (2r8p B:333-527)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1844143Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 1844144Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 1844736Family c.36.1.0: automated matches [227300] (1 protein)
    not a true family
  6. 1844737Protein automated matches [227126] (15 species)
    not a true protein
  7. 1844790Species Escherichia coli K-12 [TaxId:83333] [255577] (2 PDB entries)
  8. 1844794Domain d2r8pb1: 2r8p B:333-527 [151740]
    Other proteins in same PDB: d2r8pa2, d2r8pa3, d2r8pb2, d2r8pb3
    automated match to d2r8pb1
    complexed with ca, edo, t6f

Details for d2r8pb1

PDB Entry: 2r8p (more details), 1.65 Å

PDB Description: transketolase from e. coli in complex with substrate d-fructose-6- phosphate
PDB Compounds: (B:) Transketolase 1

SCOPe Domain Sequences for d2r8pb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r8pb1 c.36.1.0 (B:333-527) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mpsdfdakakefiaklqanpakiasrkasqnaieafgpllpeflggsadlapsnltlwsg
skainedaagnyihygvrefgmtaiangislhggflpytstflmfveyarnavrmaalmk
qrqvmvythdsiglgedgpthqpveqvaslrvtpnmstwrpcdqvesavawkygverqdg
ptalilsrqnlaqqe

SCOPe Domain Coordinates for d2r8pb1:

Click to download the PDB-style file with coordinates for d2r8pb1.
(The format of our PDB-style files is described here.)

Timeline for d2r8pb1: