Lineage for d2r8kb2 (2r8k B:1-389)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1951566Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 1951567Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 1952995Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (5 proteins)
    contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2)
  6. 1953064Protein DNA polymerase eta [100892] (1 species)
  7. 1953065Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [100893] (3 PDB entries)
  8. 1953071Domain d2r8kb2: 2r8k B:1-389 [151730]
    Other proteins in same PDB: d2r8ka1, d2r8kb1
    automatically matched to d1jiha2
    protein/DNA complex; complexed with ca, cpt, dtp

Details for d2r8kb2

PDB Entry: 2r8k (more details), 3.3 Å

PDB Description: Structure of the Eukaryotic DNA Polymerase eta in complex with 1,2-d(GpG)-cisplatin containing DNA
PDB Compounds: (B:) DNA Polymerase ETA

SCOPe Domain Sequences for d2r8kb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r8kb2 e.8.1.7 (B:1-389) DNA polymerase eta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mskftwkeliqlgspskayesslaciahidmnaffaqveqmrcglskedpvvcvqwnsii
avsyaarkygisrmdtiqealkkcsnlipihtavfkkgedfwqyhdgcgswvqdpakqis
vedhkvslepyrresrkalkifksacdlverasidevfldlgricfnmlmfdneyeltgd
lklkdalsnireafiggnydinshlplipekikslkfegdvfnpegrdlitdwddvilal
gsqvckgirdsikdilgyttscglsstknvcklasnykkpdaqtivkndclldfldcgkf
eitsfwtlggvlgkelidvldlphensikhiretwpdnagqlkefldakvkqsdydrsts
nidplktadlaeklfklsrgryglplssr

SCOPe Domain Coordinates for d2r8kb2:

Click to download the PDB-style file with coordinates for d2r8kb2.
(The format of our PDB-style files is described here.)

Timeline for d2r8kb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2r8kb1