Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily) beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology |
Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families) |
Family d.240.1.0: automated matches [231323] (1 protein) not a true family |
Protein automated matches [231324] (5 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [231491] (7 PDB entries) |
Domain d2r8ja1: 2r8j A:390-509 [151723] Other proteins in same PDB: d2r8ja2, d2r8ja3, d2r8jb2 automated match to d3mfha2 protein/DNA complex; complexed with ca, cpt, dcp |
PDB Entry: 2r8j (more details), 3.1 Å
SCOPe Domain Sequences for d2r8ja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r8ja1 d.240.1.0 (A:390-509) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} pvvksmmsnknlrgkscnsivdciswlevfcaeltsriqdleqeynkiviprtvsislkt ksyevyrksgpvaykginfqshellkvgikfvtdldikgknksyypltklsmtitnfdii
Timeline for d2r8ja1: