SCOPe 2.08: Domain d2r8ja1: 2r8j A:390-509

Lineage for d2r8ja1 (2r8j A:390-509)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
   beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology

4. Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families)

5. Family d.240.1.0: automated matches [231323] (1 protein)
   not a true family

6. Protein automated matches [231324] (5 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [231491] (7 PDB entries)

8. Domain d2r8ja1: 2r8j A:390-509 [151723]
   Other proteins in same PDB: d2r8ja2, d2r8ja3, d2r8jb2
   automated match to d3mfha2
   protein/DNA complex; complexed with ca, cpt, dcp

Details for d2r8ja1

PDB Entry: 2r8j, 3.1 Å

PDB Description: Structure of the Eukaryotic DNA Polymerase eta in complex with 1,2-d(GpG)-cisplatin containing DNA

PDB Compounds: (A:) DNA Polymerase ETA

SCOPe Domain Sequences for d2r8ja1:

Sequence; same for both SEQRES and ATOM records:

>d2r8ja1 d.240.1.0 (A:390-509) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pvvksmmsnknlrgkscnsivdciswlevfcaeltsriqdleqeynkiviprtvsislkt
ksyevyrksgpvaykginfqshellkvgikfvtdldikgknksyypltklsmtitnfdii

Timeline for d2r8ja1:

• d2r8ja1 first appeared in SCOP 1.75
  
• d2r8ja1 appears in SCOPe 2.07