Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (18 families) the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
Family c.1.9.18: Zn-dependent arginine carboxypeptidase-like [159408] (3 proteins) |
Protein Uncharacterized protein EAJ56179 [159413] (1 species) |
Species Unidentified organism [TaxId:32644] [159414] (1 PDB entry) 94% identity to the Burkholderia phytofirmans ortholog Bphyt_2089 (Uniprot B2T4I1) |
Domain d2r8cg2: 2r8c G:58-368 [151711] Other proteins in same PDB: d2r8ca1, d2r8cb1, d2r8cc1, d2r8cd1, d2r8ce1, d2r8cf1, d2r8cg1, d2r8ch1 automatically matched to 2R8C A:58-368 complexed with zn |
PDB Entry: 2r8c (more details), 2.31 Å
SCOP Domain Sequences for d2r8cg2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r8cg2 c.1.9.18 (G:58-368) Uncharacterized protein EAJ56179 {Unidentified organism [TaxId: 32644]} glidlhvhvvaiefnlprvatlpnvlvtlravpimramlrrgfttvrdaggagypfkqav esglvegprlfvsgralsqtgghadprarsdymppdspcgccvrvgalgrvadgvdevrr avreelqmgadqikimasggvasptdpvgvfgysedeiraivaeaqgrgtyvlahaytpa aiaravrcgvrtiehgnliddetarlvaehgayvvptlvtydalasegekyglppesiak iadvhgaglhsieimkragvkmgfgtdllgeaqrlqsdefrilaevlspaeviasativs aevlgmqdklg
Timeline for d2r8cg2: