Lineage for d2r8cg2 (2r8c G:58-368)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 816850Superfamily c.1.9: Metallo-dependent hydrolases [51556] (18 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 817219Family c.1.9.18: Zn-dependent arginine carboxypeptidase-like [159408] (3 proteins)
  6. 817220Protein Uncharacterized protein EAJ56179 [159413] (1 species)
  7. 817221Species Unidentified organism [TaxId:32644] [159414] (1 PDB entry)
    94% identity to the Burkholderia phytofirmans ortholog Bphyt_2089 (Uniprot B2T4I1)
  8. 817228Domain d2r8cg2: 2r8c G:58-368 [151711]
    Other proteins in same PDB: d2r8ca1, d2r8cb1, d2r8cc1, d2r8cd1, d2r8ce1, d2r8cf1, d2r8cg1, d2r8ch1
    automatically matched to 2R8C A:58-368
    complexed with zn

Details for d2r8cg2

PDB Entry: 2r8c (more details), 2.31 Å

PDB Description: Crystal structure of uncharacterized protein EAJ56179
PDB Compounds: (G:) putative amidohydrolase

SCOP Domain Sequences for d2r8cg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r8cg2 c.1.9.18 (G:58-368) Uncharacterized protein EAJ56179 {Unidentified organism [TaxId: 32644]}
glidlhvhvvaiefnlprvatlpnvlvtlravpimramlrrgfttvrdaggagypfkqav
esglvegprlfvsgralsqtgghadprarsdymppdspcgccvrvgalgrvadgvdevrr
avreelqmgadqikimasggvasptdpvgvfgysedeiraivaeaqgrgtyvlahaytpa
aiaravrcgvrtiehgnliddetarlvaehgayvvptlvtydalasegekyglppesiak
iadvhgaglhsieimkragvkmgfgtdllgeaqrlqsdefrilaevlspaeviasativs
aevlgmqdklg

SCOP Domain Coordinates for d2r8cg2:

Click to download the PDB-style file with coordinates for d2r8cg2.
(The format of our PDB-style files is described here.)

Timeline for d2r8cg2:

  • d2r8cg2 is new in SCOP 1.75
  • d2r8cg2 became obsolete in SCOPe 2.01