Lineage for d2r8cg1 (2r8c G:2-57,G:369-414)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 811542Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 811543Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (11 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 811728Family b.92.1.9: Zn-dependent arginine carboxypeptidase-like [159340] (3 proteins)
  6. 811729Protein Uncharacterized protein EAJ56179 [159341] (1 species)
  7. 811730Species Unidentified organism [TaxId:32644] [159342] (1 PDB entry)
    94% identity to the Burkholderia phytofirmans ortholog Bphyt_2089 (Uniprot B2T4I1)
  8. 811737Domain d2r8cg1: 2r8c G:2-57,G:369-414 [151710]
    Other proteins in same PDB: d2r8ca2, d2r8cb2, d2r8cc2, d2r8cd2, d2r8ce2, d2r8cf2, d2r8cg2, d2r8ch2
    automatically matched to 2R8C A:2-57,A:369-414
    complexed with zn

Details for d2r8cg1

PDB Entry: 2r8c (more details), 2.31 Å

PDB Description: Crystal structure of uncharacterized protein EAJ56179
PDB Compounds: (G:) putative amidohydrolase

SCOP Domain Sequences for d2r8cg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r8cg1 b.92.1.9 (G:2-57,G:369-414) Uncharacterized protein EAJ56179 {Unidentified organism [TaxId: 32644]}
ttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktimpXriv
pgahadvlvvdgnplksvdcllgqgehiplvmkdgrlfvnele

SCOP Domain Coordinates for d2r8cg1:

Click to download the PDB-style file with coordinates for d2r8cg1.
(The format of our PDB-style files is described here.)

Timeline for d2r8cg1:

  • d2r8cg1 is new in SCOP 1.75
  • d2r8cg1 became obsolete in SCOPe 2.01