SCOP 1.75: Domain d2r8ca1: 2r8c A:2-57,A:369-414

Lineage for d2r8ca1 (2r8c A:2-57,A:369-414)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
   pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns

4. Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (11 families)
   this domain is interrupted by the catalytic beta/alpha barrel domain

5. Family b.92.1.9: Zn-dependent arginine carboxypeptidase-like [159340] (3 proteins)

6. Protein Uncharacterized protein EAJ56179 [159341] (1 species)

7. Species Unidentified organism [TaxId:32644] [159342] (1 PDB entry)
   94% identity to the Burkholderia phytofirmans ortholog Bphyt_2089 (Uniprot B2T4I1)

8. Domain d2r8ca1: 2r8c A:2-57,A:369-414 [151698]
   Other proteins in same PDB: d2r8ca2, d2r8cb2, d2r8cc2, d2r8cd2, d2r8ce2, d2r8cf2, d2r8cg2, d2r8ch2
   complexed with zn

Details for d2r8ca1

PDB Entry: 2r8c, 2.31 Å

PDB Description: Crystal structure of uncharacterized protein EAJ56179

PDB Compounds: (A:) putative amidohydrolase

SCOP Domain Sequences for d2r8ca1:

Sequence; same for both SEQRES and ATOM records:

>d2r8ca1 b.92.1.9 (A:2-57,A:369-414) Uncharacterized protein EAJ56179 {Unidentified organism [TaxId: 32644]}
ttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktimpXriv
pgahadvlvvdgnplksvdcllgqgehiplvmkdgrlfvnele

Timeline for d2r8ca1:

• d2r8ca1 is new in SCOP 1.75
  
• d2r8ca1 does not appear in SCOPe 2.01