Class a: All alpha proteins [46456] (284 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Myoglobin [46469] (9 species) |
Species Pig (Sus scrofa) [TaxId:9823] [46473] (17 PDB entries) |
Domain d1mdna_: 1mdn A: [15169] complexed with hem |
PDB Entry: 1mdn (more details), 1.98 Å
SCOPe Domain Sequences for d1mdna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mdna_ a.1.1.2 (A:) Myoglobin {Pig (Sus scrofa) [TaxId: 9823]} glsdgewqlvlnvwgkveadvaghgqevlirlfkghpetlekfdkfkhlksedemkased lkkhgntnltalggilkkkghheaeltplaqshatkhkipvkylefiseaiiqvlqskhp gdfgadaqgamskalelfrndmaakykelgfqg
Timeline for d1mdna_: