Lineage for d2r86b1 (2r86 B:1-99)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1591384Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 1591385Superfamily c.30.1: PreATP-grasp domain [52440] (9 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 1591644Family c.30.1.8: PurP N-terminal domain-like [159526] (1 protein)
    Pfam PF06849; DUF1246
  6. 1591645Protein 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP [159527] (3 species)
  7. 1591651Species Pyrococcus furiosus [TaxId:2261] [159528] (4 PDB entries)
    Uniprot Q8U0R7 1-99
  8. 1591663Domain d2r86b1: 2r86 B:1-99 [151682]
    Other proteins in same PDB: d2r86a2, d2r86b2
    automated match to d2r84a1
    complexed with atp, mpd, na, po4

Details for d2r86b1

PDB Entry: 2r86 (more details), 2.5 Å

PDB Description: crystal structure of purp from pyrococcus furiosus complexed with atp
PDB Compounds: (B:) PurP protein PF1517

SCOPe Domain Sequences for d2r86b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r86b1 c.30.1.8 (B:1-99) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Pyrococcus furiosus [TaxId: 2261]}
mkvriatyashsalqilkgakdegfetiafgsskvkplytkyfpvadyfieekypeeell
nlnavvvptgsfvahlgielvenmkvpyfgnkrvlrwes

SCOPe Domain Coordinates for d2r86b1:

Click to download the PDB-style file with coordinates for d2r86b1.
(The format of our PDB-style files is described here.)

Timeline for d2r86b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2r86b2