Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) |
Family d.142.1.9: PurP ATP-binding domain-like [160804] (1 protein) Pfam PF06973; DUF1297 |
Protein 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP [160805] (3 species) |
Species Pyrococcus furiosus [TaxId:2261] [160808] (4 PDB entries) Uniprot Q8U0R7 100-334 |
Domain d2r86a2: 2r86 A:100-334 [151681] Other proteins in same PDB: d2r86a1, d2r86b1 automated match to d2r84a2 complexed with atp, mpd, na, po4 |
PDB Entry: 2r86 (more details), 2.5 Å
SCOPe Domain Sequences for d2r86a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r86a2 d.142.1.9 (A:100-334) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Pyrococcus furiosus [TaxId: 2261]} drnlerkwlkkagirvpevyedpddiekpvivkphgakggkgyflakdpedfwrkaekfl gikrkedlkniqiqeyvlgvpvyphyfyskvreelelmsidrryesnvdaigripakdql efdmditytvignipivlresllmdvieagervvkaaeelmgglwgpfclegvftpdlef vvfeisarivagtnifvngspytwlrydrpvstgrriameireaiendmlekvlt
Timeline for d2r86a2: