Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (9 families) precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
Family c.30.1.8: PurP N-terminal domain-like [159526] (1 protein) Pfam PF06849; DUF1246 |
Protein 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP [159527] (3 species) |
Species Pyrococcus furiosus [TaxId:2261] [159528] (4 PDB entries) Uniprot Q8U0R7 1-99 |
Domain d2r86a1: 2r86 A:1-99 [151680] Other proteins in same PDB: d2r86a2, d2r86b2 automated match to d2r84a1 complexed with atp, mpd, na, po4 |
PDB Entry: 2r86 (more details), 2.5 Å
SCOPe Domain Sequences for d2r86a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r86a1 c.30.1.8 (A:1-99) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Pyrococcus furiosus [TaxId: 2261]} mkvriatyashsalqilkgakdegfetiafgsskvkplytkyfpvadyfieekypeeell nlnavvvptgsfvahlgielvenmkvpyfgnkrvlrwes
Timeline for d2r86a1: