Lineage for d1mnob_ (1mno B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 901762Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 901763Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 901830Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 903195Protein Myoglobin [46469] (9 species)
  7. 903259Species Pig (Sus scrofa) [TaxId:9823] [46473] (17 PDB entries)
  8. 903271Domain d1mnob_: 1mno B: [15168]
    complexed with hem, oxy

Details for d1mnob_

PDB Entry: 1mno (more details), 1.95 Å

PDB Description: v68n myoglobin oxy form
PDB Compounds: (B:) protein (myoglobin)

SCOPe Domain Sequences for d1mnob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mnob_ a.1.1.2 (B:) Myoglobin {Pig (Sus scrofa) [TaxId: 9823]}
glsdgewqlvlnvwgkveadvaghgqevlirlfkghpetlekfdkfkhlksedemkased
lkkhgntnltalggilkkkghheaeltplaqshatkhkipvkylefiseaiiqvlqskhp
gdfgadaqgamskalelfrndmaakykelgfqg

SCOPe Domain Coordinates for d1mnob_:

Click to download the PDB-style file with coordinates for d1mnob_.
(The format of our PDB-style files is described here.)

Timeline for d1mnob_: