SCOP 1.73: Domain d1mnob_: 1mno B:

Lineage for d1mnob_ (1mno B:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [46473] (17 PDB entries)

8. Domain d1mnob_: 1mno B: [15168]
   complexed with hem, o2; mutant

Details for d1mnob_

PDB Entry: 1mno, 1.95 Å

PDB Description: v68n myoglobin oxy form

PDB Compounds: (B:) protein (myoglobin)

SCOP Domain Sequences for d1mnob_:

Sequence; same for both SEQRES and ATOM records:

>d1mnob_ a.1.1.2 (B:) Myoglobin {Pig (Sus scrofa) [TaxId: 9823]}
glsdgewqlvlnvwgkveadvaghgqevlirlfkghpetlekfdkfkhlksedemkased
lkkhgntnltalggilkkkghheaeltplaqshatkhkipvkylefiseaiiqvlqskhp
gdfgadaqgamskalelfrndmaakykelgfqg

Timeline for d1mnob_:

• d1mnob_ first appeared (with stable ids) in SCOP 1.55
  
• d1mnob_ appears in SCOP 1.71
  
• d1mnob_ appears in SCOP 1.75
  
• d1mnob_ appears in the current release, SCOPe 2.08