Lineage for d1mnoa_ (1mno A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 4Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 11Family a.1.1.2: Globins [46463] (16 proteins)
  6. 533Protein Myoglobin [46469] (9 species)
  7. 557Species Pig (Sus scrofa) [TaxId:9823] [46473] (17 PDB entries)
  8. 568Domain d1mnoa_: 1mno A: [15167]

Details for d1mnoa_

PDB Entry: 1mno (more details), 1.95 Å

PDB Description: v68n myoglobin oxy form

SCOP Domain Sequences for d1mnoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mnoa_ a.1.1.2 (A:) Myoglobin {Pig (Sus scrofa)}
glsdgewqlvlnvwgkveadvaghgqevlirlfkghpetlekfdkfkhlksedemkased
lkkhgntnltalggilkkkghheaeltplaqshatkhkipvkylefiseaiiqvlqskhp
gdfgadaqgamskalelfrndmaakykelgfqg

SCOP Domain Coordinates for d1mnoa_:

Click to download the PDB-style file with coordinates for d1mnoa_.
(The format of our PDB-style files is described here.)

Timeline for d1mnoa_: