Lineage for d2r82a2 (2r82 A:377-509)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2850950Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 2850951Superfamily c.8.1: Phosphohistidine domain [52009] (3 families) (S)
    contains barrel, closed, n=7, S=10
  5. 2850952Family c.8.1.1: Pyruvate phosphate dikinase, central domain [52010] (1 protein)
  6. 2850953Protein Pyruvate phosphate dikinase, central domain [52011] (3 species)
  7. 2850954Species Clostridium symbiosum [TaxId:1512] [52012] (8 PDB entries)
  8. 2850961Domain d2r82a2: 2r82 A:377-509 [151668]
    Other proteins in same PDB: d2r82a1, d2r82a3
    automatically matched to d1kbla2
    complexed with so4; mutant

Details for d2r82a2

PDB Entry: 2r82 (more details), 3.6 Å

PDB Description: pyruvate phosphate dikinase (ppdk) triple mutant r219e/e271r/s262d adapts a second conformational state
PDB Compounds: (A:) Pyruvate, phosphate dikinase

SCOPe Domain Sequences for d2r82a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r82a2 c.8.1.1 (A:377-509) Pyruvate phosphate dikinase, central domain {Clostridium symbiosum [TaxId: 1512]}
lhptfnpaalkagevigsalpaspgaaagkvyftadeakaahekgervilvrletspedi
egmhaaegiltvrggmtshaavvargmgtccvsgcgeikineeaktfelgghtfaegdyi
sldgstgkiykgd

SCOPe Domain Coordinates for d2r82a2:

Click to download the PDB-style file with coordinates for d2r82a2.
(The format of our PDB-style files is described here.)

Timeline for d2r82a2: