Lineage for d2r7zg1 (2r7z G:1-171)

  1. Root: SCOP 1.75
  2. 896322Class i: Low resolution protein structures [58117] (26 folds)
  3. 898089Fold i.8: RNA polymerase [58180] (1 superfamily)
  4. 898090Superfamily i.8.1: RNA polymerase [58181] (1 family) (S)
  5. 898091Family i.8.1.1: RNA polymerase [58182] (2 proteins)
  6. 898092Protein Complete 12-subunit RNA polymerase II complex [90261] (1 species)
  7. 898093Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [90262] (23 PDB entries)
  8. 898098Domain d2r7zg1: 2r7z G:1-171 [151662]
    Other proteins in same PDB: d2r7zb1, d2r7zf1, d2r7zh1, d2r7zj1, d2r7zl1
    automatically matched to d1wcmg_
    complexed with cpt, mg, zn

Details for d2r7zg1

PDB Entry: 2r7z (more details), 3.8 Å

PDB Description: cisplatin lesion containing rna polymerase ii elongation complex
PDB Compounds: (G:) DNA-directed RNA polymerase II subunit RPB7

SCOP Domain Sequences for d2r7zg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r7zg1 i.8.1.1 (G:1-171) Complete 12-subunit RNA polymerase II complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mffikdlslnitlhpsffgprmkqylktklleevegsctgkfgyilcvldydnidiqrgr
ilptdgsaefnvkyravvfkpfkgevvdgtvvscsqhgfevqvgpmkvfvtkhlmpqdlt
fnagsnppsyqssedvitiksrirvkiegcisqvssihaigsikedylgai

SCOP Domain Coordinates for d2r7zg1:

Click to download the PDB-style file with coordinates for d2r7zg1.
(The format of our PDB-style files is described here.)

Timeline for d2r7zg1: