Lineage for d1m6cb_ (1m6c B:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies) Superfamily a.1.1: Globin-like [46458] (3 families) 
Family a.1.1.2: Globins [46463] (16 proteins) Protein Myoglobin [46469] (9 species) 
Species Pig (Sus scrofa) [TaxId:9823] [46473] (17 PDB entries) 
Domain d1m6cb_: 1m6c B: [15166]
Details for d1m6cb_
PDB Entry: 1m6c (more details), 1.9 Å
PDB Description: v68n myoglobin with co
SCOP Domain Sequences for d1m6cb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m6cb_ a.1.1.2 (B:) Myoglobin {Pig (Sus scrofa)}
glsdgewqlvlnvwgkveadvaghgqevlirlfkghpetlekfdkfkhlksedemkased
lkkhgntnltalggilkkkghheaeltplaqshatkhkipvkylefiseaiiqvlqskhp
gdfgadaqgamskalelfrndmaakykelgfqg
SCOP Domain Coordinates for d1m6cb_:
Click to download the PDB-style file with coordinates for d1m6cb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1m6cb_:
- d1m6cb_ appears in SCOP 1.57
- d1m6cb_ appears in the current release, SCOPe 2.08
View in 3D
