Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (8 families) precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
Family c.30.1.8: PurP N-terminal domain-like [159526] (1 protein) Pfam PF06849; DUF1246 |
Protein 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP [159527] (3 species) |
Species Methanocaldococcus jannaschii [TaxId:2190] [159530] (4 PDB entries) Uniprot Q57600 1-123 |
Domain d2r7na1: 2r7n A:1-123 [151653] Other proteins in same PDB: d2r7na2 automatically matched to 2R7K A:1-123 complexed with adp, cl, fai, so4 |
PDB Entry: 2r7n (more details), 2.4 Å
SCOP Domain Sequences for d2r7na1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r7na1 c.30.1.8 (A:1-123) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Methanocaldococcus jannaschii [TaxId: 2190]} miskdeileifdkynkdeitiatlgshtslhilkgaklegfstvcitmkgrdvpykrfkv adkfiyvdnfsdikneeiqeklrelnsivvphgsfiaycgldnvensflvpmfgnrrilr wes
Timeline for d2r7na1: