Lineage for d1m6ca_ (1m6c A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 530467Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 530468Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 530506Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 531553Protein Myoglobin [46469] (9 species)
  7. 531584Species Pig (Sus scrofa) [TaxId:9823] [46473] (17 PDB entries)
  8. 531593Domain d1m6ca_: 1m6c A: [15165]

Details for d1m6ca_

PDB Entry: 1m6c (more details), 1.9 Å

PDB Description: v68n myoglobin with co

SCOP Domain Sequences for d1m6ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m6ca_ a.1.1.2 (A:) Myoglobin {Pig (Sus scrofa)}
glsdgewqlvlnvwgkveadvaghgqevlirlfkghpetlekfdkfkhlksedemkased
lkkhgntnltalggilkkkghheaeltplaqshatkhkipvkylefiseaiiqvlqskhp
gdfgadaqgamskalelfrndmaakykelgfqg

SCOP Domain Coordinates for d1m6ca_:

Click to download the PDB-style file with coordinates for d1m6ca_.
(The format of our PDB-style files is described here.)

Timeline for d1m6ca_: