SCOPe 2.08: Domain d2r7ga1: 2r7g A:380-578

Lineage for d2r7ga1 (2r7g A:380-578)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.3: Retinoblastoma tumor suppressor domains [47969] (1 protein)

6. Protein Retinoblastoma tumor suppressor domains [47970] (1 species)
   contains an additional C-terminal helix

7. Species Human (Homo sapiens) [TaxId:9606] [47971] (7 PDB entries)

8. Domain d2r7ga1: 2r7g A:380-578 [151637]
   automated match to d1n4ma1
   complexed with so4
   has additional insertions and/or extensions that are not grouped together

Details for d2r7ga1

PDB Entry: 2r7g, 1.67 Å

PDB Description: structure of the retinoblastoma protein pocket domain in complex with adenovirus e1a cr1 domain

PDB Compounds: (A:) Retinoblastoma-associated protein

SCOPe Domain Sequences for d2r7ga1:

Sequence, based on SEQRES records:

>d2r7ga1 a.74.1.3 (A:380-578) Retinoblastoma tumor suppressor domains {Human (Homo sapiens) [TaxId: 9606]}
ntiqqlmmilnsasdqpsenlisyfnnctvnpkesilkrvkdigyifkekfakavgqgcv
eigsqryklgvrlyyrvmesmlkseeerlsiqnfskllndnifhmsllacalevvmatys
rstsqnldsgtdlsfpwilnvlnlkafdfykviesfikaegnltremikhlercehrime
slawlsdsplfdlikqskd

Sequence, based on observed residues (ATOM records):

>d2r7ga1 a.74.1.3 (A:380-578) Retinoblastoma tumor suppressor domains {Human (Homo sapiens) [TaxId: 9606]}
ntiqqlmmilnsasdqpsenlisyfnnctvnpkesilkrvkdigyifkekfakavgqgcv
eigsqryklgvrlyyrvmesmlkseeerlsiqnfskllndnifhmsllacalevvmatys
rstgtdlsfpwilnvlnlkafdfykviesfikaegnltremikhlercehrimeslawls
dsplfdlikqskd

Timeline for d2r7ga1:

• d2r7ga1 first appeared in SCOP 1.75
  
• d2r7ga1 appears in SCOPe 2.07