SCOP 1.75: Domain d2r7db2: 2r7d B:3-403

Lineage for d2r7db2 (2r7d B:3-403)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families)

5. Family b.40.4.16: RNB domain-like [159112] (3 proteins)
   Pfam PF00773; RNase II catalytic domain; decorated OB-fold domain with extra C-terminal structures forming the active site

6. Protein Ribonuclease II family protein DR0020 [159115] (1 species)
   Includes extra N-terminal all-alpha subdomain

7. Species Deinococcus radiodurans [TaxId:1299] [159116] (2 PDB entries)
   Uniprot Q9RYD0 3-403

8. Domain d2r7db2: 2r7d B:3-403 [151632]
   Other proteins in same PDB: d2r7da1, d2r7db1, d2r7dc1
   automatically matched to 2R7D A:3-403
   complexed with mg

Details for d2r7db2

PDB Entry: 2r7d, 1.8 Å

PDB Description: crystal structure of ribonuclease ii family protein from deinococcus radiodurans, triclinic crystal form. northeast structural genomics target drr63

PDB Compounds: (B:) Ribonuclease II family protein

SCOP Domain Sequences for d2r7db2:

Sequence; same for both SEQRES and ATOM records:

>d2r7db2 b.40.4.16 (B:3-403) Ribonuclease II family protein DR0020 {Deinococcus radiodurans [TaxId: 1299]}
qpeltpaqrtevellargradksrvlrdlklpetpeaahalllrlgvwdeartpyadrlr
aalnavelpvpdfdpaeerldlthlptfaiddegnqdpddavgvedlgggltrlwvhvad
vaalvapdspldlearargatlylpdrtigmlpdelvakaglglhevspalsicldldpd
gnaeavdvlltrvkvqrlayqeaqarleageepfvtlarlarasrrlregegalsidlpe
vrvkadetgasvfplpkpemrtvvqecmtlagwgtaifaddneiplpfatqdyptrevag
dtlpamwarrktlartrfqpspgphhgmgldlyaqatspmrryldlvvhqqlraflagrd
plsskvmaahiaesqmnadatrqaerlsrrhhtlrfiaaqp

Timeline for d2r7db2:

• d2r7db2 is new in SCOP 1.75
  
• d2r7db2 appears in SCOPe 2.01
  
• d2r7db2 appears in the current release, SCOPe 2.08