Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins) barrel, closed; n=5, S=8 |
Protein Ribonuclease II family protein DR0020 [159094] (1 species) |
Species Deinococcus radiodurans [TaxId:1299] [159095] (2 PDB entries) Uniprot Q9RYD0 404-461 |
Domain d2r7db1: 2r7d B:404-461 [151631] Other proteins in same PDB: d2r7da2, d2r7da3, d2r7db2, d2r7dc2 automated match to d2r7da1 complexed with mg |
PDB Entry: 2r7d (more details), 1.8 Å
SCOPe Domain Sequences for d2r7db1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r7db1 b.40.4.5 (B:404-461) Ribonuclease II family protein DR0020 {Deinococcus radiodurans [TaxId: 1299]} ervwdavvvdrrgaqatllipdlafdvqvntpaapgtalqvqfadidlpqmrvrarsv
Timeline for d2r7db1: