Lineage for d2r7db1 (2r7d B:404-461)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789672Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins)
    barrel, closed; n=5, S=8
  6. 2789944Protein Ribonuclease II family protein DR0020 [159094] (1 species)
  7. 2789945Species Deinococcus radiodurans [TaxId:1299] [159095] (2 PDB entries)
    Uniprot Q9RYD0 404-461
  8. 2789947Domain d2r7db1: 2r7d B:404-461 [151631]
    Other proteins in same PDB: d2r7da2, d2r7da3, d2r7db2, d2r7dc2
    automated match to d2r7da1
    complexed with mg

Details for d2r7db1

PDB Entry: 2r7d (more details), 1.8 Å

PDB Description: crystal structure of ribonuclease ii family protein from deinococcus radiodurans, triclinic crystal form. northeast structural genomics target drr63
PDB Compounds: (B:) Ribonuclease II family protein

SCOPe Domain Sequences for d2r7db1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r7db1 b.40.4.5 (B:404-461) Ribonuclease II family protein DR0020 {Deinococcus radiodurans [TaxId: 1299]}
ervwdavvvdrrgaqatllipdlafdvqvntpaapgtalqvqfadidlpqmrvrarsv

SCOPe Domain Coordinates for d2r7db1:

Click to download the PDB-style file with coordinates for d2r7db1.
(The format of our PDB-style files is described here.)

Timeline for d2r7db1: