SCOPe 2.01: Domain d2r7da1: 2r7d A:404-461

Lineage for d2r7da1 (2r7d A:404-461)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
   barrel, closed; n=5, S=8

6. Protein Ribonuclease II family protein DR0020 [159094] (1 species)

7. Species Deinococcus radiodurans [TaxId:1299] [159095] (2 PDB entries)
   Uniprot Q9RYD0 404-461

8. Domain d2r7da1: 2r7d A:404-461 [151629]
   Other proteins in same PDB: d2r7da2, d2r7db2, d2r7dc2
   complexed with mg

Details for d2r7da1

PDB Entry: 2r7d, 1.8 Å

PDB Description: crystal structure of ribonuclease ii family protein from deinococcus radiodurans, triclinic crystal form. northeast structural genomics target drr63

PDB Compounds: (A:) Ribonuclease II family protein

SCOPe Domain Sequences for d2r7da1:

Sequence; same for both SEQRES and ATOM records:

>d2r7da1 b.40.4.5 (A:404-461) Ribonuclease II family protein DR0020 {Deinococcus radiodurans [TaxId: 1299]}
ervwdavvvdrrgaqatllipdlafdvqvntpaapgtalqvqfadidlpqmrvrarsv

Timeline for d2r7da1:

• d2r7da1 first appeared in SCOP 1.75
  
• d2r7da1 appears in SCOPe 2.02
  
• d2r7da1 appears in the current release, SCOPe 2.08