Lineage for d2r6ya1 (2r6y A:306-549)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 776482Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 776483Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 776484Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (33 proteins)
  6. 776557Protein Estrogen receptor alpha [48519] (1 species)
  7. 776558Species Human (Homo sapiens) [TaxId:9606] [48520] (29 PDB entries)
    Uniprot P03372 307-551
  8. 776569Domain d2r6ya1: 2r6y A:306-549 [151623]
    automatically matched to d1qkta_
    complexed with llc; mutant

Details for d2r6ya1

PDB Entry: 2r6y (more details), 2 Å

PDB Description: Estrogen receptor alpha ligand-binding domain in complex with a SERM
PDB Compounds: (A:) Estrogen receptor

SCOP Domain Sequences for d2r6ya1:

Sequence, based on SEQRES records: (download)

>d2r6ya1 a.123.1.1 (A:306-549) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]}
lalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvp
gfvdltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveif
dmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdt
lihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmksknvvplydlllemld
ahrl

Sequence, based on observed residues (ATOM records): (download)

>d2r6ya1 a.123.1.1 (A:306-549) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]}
lalsltadqmvsalldaeppilyseydpsmmglltnladrelvhminwakrvpgfvdltl
hdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveifdmllats
srfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdtlihlmak
agltlqqqhqrlaqlllilshirhmsnkgmehlysmvplydlllemldahrl

SCOP Domain Coordinates for d2r6ya1:

Click to download the PDB-style file with coordinates for d2r6ya1.
(The format of our PDB-style files is described here.)

Timeline for d2r6ya1: