Lineage for d2r6wa_ (2r6w A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1280249Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 1280250Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 1280251Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 1280336Protein Estrogen receptor alpha [48519] (1 species)
  7. 1280337Species Human (Homo sapiens) [TaxId:9606] [48520] (59 PDB entries)
    Uniprot P03372 307-551
  8. 1280371Domain d2r6wa_: 2r6w A: [151621]
    automated match to d1qkta_
    protein/DNA complex; complexed with llb

Details for d2r6wa_

PDB Entry: 2r6w (more details), 2 Å

PDB Description: Estrogen receptor alpha ligand-binding domain complexed to a SERM
PDB Compounds: (A:) Estrogen receptor

SCOPe Domain Sequences for d2r6wa_:

Sequence, based on SEQRES records: (download)

>d2r6wa_ a.123.1.1 (A:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]}
lalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvp
gfvdltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveif
dmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdt
lihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmksknvvplydlllemld
ahrl

Sequence, based on observed residues (ATOM records): (download)

>d2r6wa_ a.123.1.1 (A:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]}
lalsltadqmvsalldaeppilyseyasmmglltnladrelvhminwakrvpgfvdltlh
dqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveifdmllatss
rfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdtlihlmaka
gltlqqqhqrlaqlllilshirhmsnkgmehlyvplydlllemldahrl

SCOPe Domain Coordinates for d2r6wa_:

Click to download the PDB-style file with coordinates for d2r6wa_.
(The format of our PDB-style files is described here.)

Timeline for d2r6wa_: