SCOP 1.75: Domain d2r6ka1: 2r6k A:81-222

Lineage for d2r6ka1 (2r6k A:81-222)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)

6. Protein Class alpha GST [81349] (8 species)

7. Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (19 PDB entries)
   Uniprot P08263

8. Domain d2r6ka1: 2r6k A:81-222 [151614]
   Other proteins in same PDB: d2r6ka2, d2r6kb2
   automatically matched to d1gsea1
   complexed with gtx; mutant

Details for d2r6ka1

PDB Entry: 2r6k, 2.51 Å

PDB Description: crystal structure of an i71v hgsta1-1 mutant in complex with s- hexylglutathione

PDB Compounds: (A:) glutathione s-transferase a1

SCOP Domain Sequences for d2r6ka1:

Sequence; same for both SEQRES and ATOM records:

>d2r6ka1 a.45.1.1 (A:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
lygkdikeralidmyiegiadlgemilllpvcppeekdaklalikekiknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkppmdeksleearkifrf

Timeline for d2r6ka1:

• d2r6ka1 is new in SCOP 1.75
  
• d2r6ka1 appears in SCOPe 2.01
  
• d2r6ka1 appears in the current release, SCOPe 2.08