Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (23 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (2 proteins) |
Protein Envelope glycoprotein [49213] (5 species) |
Species Dengue virus type 2 [TaxId:11060] [89194] (10 PDB entries) Uniprot P12823 281-675 # 99% sequence identity |
Domain d2r69a1: 2r69 A:298-394 [151601] Other proteins in same PDB: d2r69l1, d2r69l2 automatically matched to d1tgea1 |
PDB Entry: 2r69 (more details), 3.8 Å
SCOP Domain Sequences for d2r69a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r69a1 b.1.18.4 (A:298-394) Envelope glycoprotein {Dengue virus type 2 [TaxId: 11060]} sysmctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpi vtekdspvnieaeppfgdsyiiigvepgqlklnwfkk
Timeline for d2r69a1: