Lineage for d2r5yb1 (2r5y B:205-259)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 761140Superfamily a.4.1: Homeodomain-like [46689] (19 families) (S)
    consists only of helices
  5. 761141Family a.4.1.1: Homeodomain [46690] (40 proteins)
    Pfam PF00046
  6. 761179Protein Extradenticle (exd) homeodomain [46720] (1 species)
  7. 761180Species Drosophila melanogaster [TaxId:7227] [46721] (3 PDB entries)
  8. 761181Domain d2r5yb1: 2r5y B:205-259 [151597]
    automatically matched to d1b8ib_

Details for d2r5yb1

PDB Entry: 2r5y (more details), 2.6 Å

PDB Description: Structure of Scr/Exd complex bound to a consensus Hox-Exd site
PDB Compounds: (B:) Homeobox protein extradenticle

SCOP Domain Sequences for d2r5yb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r5yb1 a.4.1.1 (B:205-259) Extradenticle (exd) homeodomain {Drosophila melanogaster [TaxId: 7227]}
rrnfskqaseilneyfyshlsnpypseeakeelarkcgitvsqvsnwfgnkrirykkn

SCOP Domain Coordinates for d2r5yb1:

Click to download the PDB-style file with coordinates for d2r5yb1.
(The format of our PDB-style files is described here.)

Timeline for d2r5yb1: