| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.48: TK C-terminal domain-like [52921] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest |
Superfamily c.48.1: TK C-terminal domain-like [52922] (3 families) ![]() |
| Family c.48.1.1: Transketolase C-terminal domain-like [52923] (2 proteins) |
| Protein Transketolase (TK), C-domain [52924] (4 species) two N-terminal domains are PP and Pyr modules of thiamin-binding fold |
| Species Escherichia coli [TaxId:562] [89712] (4 PDB entries) |
| Domain d2r5nb3: 2r5n B:528-663 [151596] Other proteins in same PDB: d2r5na1, d2r5na2, d2r5nb1, d2r5nb2 automatically matched to d1qgda3 complexed with ca, edo, r5p, rp5, tpp |
PDB Entry: 2r5n (more details), 1.6 Å
SCOP Domain Sequences for d2r5nb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r5nb3 c.48.1.1 (B:528-663) Transketolase (TK), C-domain {Escherichia coli [TaxId: 562]}
rteeqlaniarggyvlkdcagqpelifiatgsevelavaayekltaegvkarvvsmpstd
afdkqdaayresvlpkavtarvaveagiadywykyvglngaivgmttfgesapaellfee
fgftvdnvvakakell
Timeline for d2r5nb3: