Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Family c.36.1.0: automated matches [227300] (1 protein) not a true family |
Protein automated matches [227126] (20 species) not a true protein |
Domain d2r5na1: 2r5n A:333-527 [151591] Other proteins in same PDB: d2r5na2, d2r5na3, d2r5na4, d2r5nb2, d2r5nb3, d2r5nb4 automated match to d2r8oa1 complexed with ca, edo, r5p, rp5, tpp |
PDB Entry: 2r5n (more details), 1.6 Å
SCOPe Domain Sequences for d2r5na1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r5na1 c.36.1.0 (A:333-527) automated matches {Escherichia coli [TaxId: 562]} mpsdfdakakefiaklqanpakiasrkasqnaieafgpllpeflggsadlapsnltlwsg skainedaagnyihygvrefgmtaiangislhggflpytstflmfveyarnavrmaalmk qrqvmvythdsiglgedgpthqpveqvaslrvtpnmstwrpcdqvesavawkygverqdg ptalilsrqnlaqqe
Timeline for d2r5na1:
View in 3D Domains from other chains: (mouse over for more information) d2r5nb1, d2r5nb2, d2r5nb3, d2r5nb4 |