Lineage for d1mwda_ (1mwd A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976495Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1978189Protein Myoglobin [46469] (10 species)
  7. 1978292Species Pig (Sus scrofa) [TaxId:9823] [46473] (17 PDB entries)
  8. 1978295Domain d1mwda_: 1mwd A: [15159]
    complexed with hem

Details for d1mwda_

PDB Entry: 1mwd (more details), 1.8 Å

PDB Description: wild type deoxy myoglobin
PDB Compounds: (A:) protein (myoglobin)

SCOPe Domain Sequences for d1mwda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mwda_ a.1.1.2 (A:) Myoglobin {Pig (Sus scrofa) [TaxId: 9823]}
glsdgewqlvlnvwgkveadvaghgqevlirlfkghpetlekfdkfkhlksedemkased
lkkhgntvltalggilkkkghheaeltplaqshatkhkipvkylefiseaiiqvlqskhp
gdfgadaqgamskalelfrndmaakykelgfqg

SCOPe Domain Coordinates for d1mwda_:

Click to download the PDB-style file with coordinates for d1mwda_.
(The format of our PDB-style files is described here.)

Timeline for d1mwda_: