Lineage for d2r5ea_ (2r5e A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2895168Family c.67.1.1: AAT-like [53384] (17 proteins)
  6. 2895476Protein Kynurenine--oxoglutarate transaminase I [110681] (2 species)
  7. 2895481Species Yellow fever mosquito (Aedes aegypti) [TaxId:7159] [142654] (4 PDB entries)
    Uniprot Q95VY4 61-477
  8. 2895484Domain d2r5ea_: 2r5e A: [151588]
    automated match to d1yiya1
    complexed with qlp

Details for d2r5ea_

PDB Entry: 2r5e (more details), 1.84 Å

PDB Description: Aedes kynurenine aminotransferase in complex with glutamine
PDB Compounds: (A:) Kynurenine aminotransferase

SCOPe Domain Sequences for d2r5ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r5ea_ c.67.1.1 (A:) Kynurenine--oxoglutarate transaminase I {Yellow fever mosquito (Aedes aegypti) [TaxId: 7159]}
nkfdlpkryqgstksvwveyiqlaaqykplnlgqgfpdyhapkyalnalaaaanspdpla
nqytrgfghprlvqalsklysqlvdrtinpmtevlvtvgayealyatiqghvdegdevii
iepffdcyepmvkaaggiprfiplkpnktggtissadwvldnnelealfnektkmiiint
phnplgkvmdraelevvanlckkwnvlcvsdevyehmvfepfehirictlpgmwertiti
gsagktfsltgwkigwaygpeallknlqmvhqncvytcatpiqeaiavgfetelkrlksp
ecyfnsisgelmakrdymasflaevgmnptvpqggyfmvadwssldskvdltqetdarkd
yrftkwmtksvglqgippsafysepnkhlgedfvrycffkkdenlqkaaeilrkwkgss

SCOPe Domain Coordinates for d2r5ea_:

Click to download the PDB-style file with coordinates for d2r5ea_.
(The format of our PDB-style files is described here.)

Timeline for d2r5ea_: