Class b: All beta proteins [48724] (177 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins) barrel, closed; n=8, S=12, meander |
Protein beta-Lactoglobulin [50827] (4 species) |
Species Cow (Bos taurus) [TaxId:9913] [50828] (56 PDB entries) Uniprot P02754 |
Domain d2r56b_: 2r56 B: [151582] Other proteins in same PDB: d2r56l1, d2r56l2, d2r56m1, d2r56m2 automated match to d1bsqa_ complexed with lmt |
PDB Entry: 2r56 (more details), 2.8 Å
SCOPe Domain Sequences for d2r56b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r56b_ b.60.1.1 (B:) beta-Lactoglobulin {Cow (Bos taurus) [TaxId: 9913]} tqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqkwen gecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacqclv rtpevddealekfdkalkalpmhirlsfnptqleeqchi
Timeline for d2r56b_: