SCOP 1.75: Domain d2r56a1: 2r56 A:4-162

Lineage for d2r56a1 (2r56 A:4-162)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (9 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (21 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein beta-Lactoglobulin [50827] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50828] (21 PDB entries)
   Uniprot P02754

8. Domain d2r56a1: 2r56 A:4-162 [151581]
   automatically matched to d1bsqa_
   complexed with lmt

Details for d2r56a1

PDB Entry: 2r56, 2.8 Å

PDB Description: Crystal Structure of a Recombinant IgE Fab Fragment in Complex with Bovine Beta-Lactoglobulin Allergen

PDB Compounds: (A:) beta-lactoglobulin

SCOP Domain Sequences for d2r56a1:

Sequence; same for both SEQRES and ATOM records:

>d2r56a1 b.60.1.1 (A:4-162) beta-Lactoglobulin {Cow (Bos taurus) [TaxId: 9913]}
tqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqkwen
gecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacqclv
rtpevddealekfdkalkalpmhirlsfnptqleeqchi

Timeline for d2r56a1:

• d2r56a1 is new in SCOP 1.75
  
• d2r56a1 is called d2r56a_ in SCOPe 2.01
  
• d2r56a1 appears in the current release, SCOPe 2.08, called d2r56a_