Class b: All beta proteins [48724] (177 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins) |
Protein Stress sensor protease DegS, catalytic domain [110236] (1 species) |
Species Escherichia coli [TaxId:562] [110237] (12 PDB entries) Uniprot P31137 37-354 ! Uniprot P31137 |
Domain d2r3yc2: 2r3y C:43-254 [151570] Other proteins in same PDB: d2r3ya1, d2r3yb1, d2r3yc1 automatically matched to d1te0a2 |
PDB Entry: 2r3y (more details), 2.5 Å
SCOPe Domain Sequences for d2r3yc2:
Sequence, based on SEQRES records: (download)
>d2r3yc2 b.47.1.1 (C:43-254) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]} tpasynlavrraapavvnvynrglntnshnqleirtlgsgvimdqrgyiitnkhvindad qiivalqdgrvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvlaignpy nlgqtitqgiisatgriglnptgrqnflqtdasinhgnsggalvnslgelmgintlsfdk sndgetpegigfaipfqlatkimdklirdgrv
>d2r3yc2 b.47.1.1 (C:43-254) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]} tpasynlavrraapavvnvynrglnqleirtlgsgvimdqrgyiitnkhvindadqiiva lqdgrvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvlaignpynlgqt itqgiisatgriglnptgrqnflqtdasinhgnsggalvnslgelmgintlsfdksndge tpegigfaipfqlatkimdklirdgrv
Timeline for d2r3yc2:
View in 3D Domains from other chains: (mouse over for more information) d2r3ya1, d2r3ya2, d2r3yb1, d2r3yb2 |