Lineage for d1mbsa_ (1mbs A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 901762Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 901763Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 901830Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 903195Protein Myoglobin [46469] (9 species)
  7. 903198Species Common seal (Phoca vitulina) [TaxId:9720] [46472] (1 PDB entry)
  8. 903199Domain d1mbsa_: 1mbs A: [15156]
    complexed with hem

Details for d1mbsa_

PDB Entry: 1mbs (more details), 2.5 Å

PDB Description: x-ray crystallographic studies of seal myoglobin. the molecule at 2.5 angstroms resolution
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d1mbsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mbsa_ a.1.1.2 (A:) Myoglobin {Common seal (Phoca vitulina) [TaxId: 9720]}
glsdgewhlvlnvwgkvetdlaghgqevlirlfkshpetlekfdkfkhlkseddmrrsed
lrkhgntvltalggilkkkghheaelkplaqshatkhkipikylefiseaiihvlhskhp
aefgadaqaamkkalelfrndiaakykelgfhg

SCOPe Domain Coordinates for d1mbsa_:

Click to download the PDB-style file with coordinates for d1mbsa_.
(The format of our PDB-style files is described here.)

Timeline for d1mbsa_: