Class a: All alpha proteins [46456] (284 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Myoglobin [46469] (9 species) |
Species Common seal (Phoca vitulina) [TaxId:9720] [46472] (1 PDB entry) |
Domain d1mbsa_: 1mbs A: [15156] complexed with hem |
PDB Entry: 1mbs (more details), 2.5 Å
SCOPe Domain Sequences for d1mbsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mbsa_ a.1.1.2 (A:) Myoglobin {Common seal (Phoca vitulina) [TaxId: 9720]} glsdgewhlvlnvwgkvetdlaghgqevlirlfkshpetlekfdkfkhlkseddmrrsed lrkhgntvltalggilkkkghheaelkplaqshatkhkipikylefiseaiihvlhskhp aefgadaqaamkkalelfrndiaakykelgfhg
Timeline for d1mbsa_: