SCOPe 2.08: Domain d1mbsa_: 1mbs A:

Lineage for d1mbsa_ (1mbs A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (11 species)

7. Species Common seal (Phoca vitulina) [TaxId:9720] [46472] (1 PDB entry)

8. Domain d1mbsa_: 1mbs A: [15156]
   complexed with hem

Details for d1mbsa_

PDB Entry: 1mbs, 2.5 Å

PDB Description: x-ray crystallographic studies of seal myoglobin. the molecule at 2.5 angstroms resolution

PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d1mbsa_:

Sequence; same for both SEQRES and ATOM records:

>d1mbsa_ a.1.1.2 (A:) Myoglobin {Common seal (Phoca vitulina) [TaxId: 9720]}
glsdgewhlvlnvwgkvetdlaghgqevlirlfkshpetlekfdkfkhlkseddmrrsed
lrkhgntvltalggilkkkghheaelkplaqshatkhkipikylefiseaiihvlhskhp
aefgadaqaamkkalelfrndiaakykelgfhg

Timeline for d1mbsa_:

• d1mbsa_ first appeared (with stable ids) in SCOP 1.55, called d1mbs__
  
• d1mbsa_ appears in SCOPe 2.07