Lineage for d4mba__ (4mba -)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 43952Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 43953Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 43963Family a.1.1.2: Globins [46463] (17 proteins)
  6. 44499Protein Myoglobin [46469] (9 species)
  7. 44557Species Sea hare (Aplysia limacina) [TaxId:6502] [46471] (7 PDB entries)
  8. 44564Domain d4mba__: 4mba - [15155]

Details for d4mba__

PDB Entry: 4mba (more details), 2 Å

PDB Description: aplysia limacina myoglobin. crystallographic analysis at 1.6 angstroms resolution

SCOP Domain Sequences for d4mba__:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mba__ a.1.1.2 (-) Myoglobin {Sea hare (Aplysia limacina)}
slsaaeadlagkswapvfanknangldflvalfekfpdsanffadfkgksvadikaspkl
rdvssriftrlnefvnnaanagkmsamlsqfakehvgfgvgsaqfenvrsmfpgfvasva
appagadaawtklfgliidalkaaga

SCOP Domain Coordinates for d4mba__:

Click to download the PDB-style file with coordinates for d4mba__.
(The format of our PDB-style files is described here.)

Timeline for d4mba__: