SCOPe 2.08: Domain d2r33b_: 2r33 B:

Lineage for d2r33b_ (2r33 B:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (2 families)

5. Family g.3.13.1: Bowman-Birk inhibitor, BBI [57248] (2 proteins)

6. Protein automated matches [192457] (4 species)
   not a true protein

7. Species Cowpea (Vigna unguiculata) [TaxId:3917] [192448] (2 PDB entries)

8. Domain d2r33b_: 2r33 B: [151549]
   Other proteins in same PDB: d2r33a1
   automated match to d2bbia_

Details for d2r33b_

PDB Entry: 2r33, 2.5 Å

PDB Description: Crystal structure of a Bowman-Birk inhibitor from Vigna unguiculata seeds

PDB Compounds: (B:) Bowman-Birk type seed trypsin and chymotrypsin inhibitor

SCOPe Domain Sequences for d2r33b_:

Sequence; same for both SEQRES and ATOM records:

>d2r33b_ g.3.13.1 (B:) automated matches {Cowpea (Vigna unguiculata) [TaxId: 3917]}
pccdscvctksippqchctnirlnschsgcksclctfsipgscrcldianfcykpck

Timeline for d2r33b_:

• d2r33b_ first appeared in SCOP 1.75, called d2r33b1
  
• d2r33b_ appears in SCOPe 2.07