Lineage for d2r25b1 (2r25 B:1087-1214)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 825505Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 825506Superfamily c.23.1: CheY-like [52172] (7 families) (S)
  5. 825507Family c.23.1.1: CheY-related [52173] (25 proteins)
  6. 825691Protein Response regulator Sin1 [102228] (1 species)
  7. 825692Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [102229] (3 PDB entries)
  8. 825693Domain d2r25b1: 2r25 B:1087-1214 [151530]
    Other proteins in same PDB: d2r25a1
    automatically matched to d1oxkb_
    complexed with bef, mg, na

Details for d2r25b1

PDB Entry: 2r25 (more details), 1.7 Å

PDB Description: complex of ypd1 and sln1-r1 with bound mg2+ and bef3-
PDB Compounds: (B:) Osmosensing histidine protein kinase SLN1

SCOP Domain Sequences for d2r25b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r25b1 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
svkilvvednhvnqevikrmlnlegienielacdgqeafdkvkeltskgenynmifmdvq
mpkvdgllstkmirrdlgytspivaltafaddsnikeclesgmngflskpikrpklktil
tefcaayq

SCOP Domain Coordinates for d2r25b1:

Click to download the PDB-style file with coordinates for d2r25b1.
(The format of our PDB-style files is described here.)

Timeline for d2r25b1: