SCOP 1.75: Domain d2r1jl1: 2r1j L:3-68

Lineage for d2r1jl1 (2r1j L:3-68)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families)

5. Family a.35.1.2: Phage repressors [47419] (7 proteins)
   consists of different sequence families of HTH repressors of phage origins

6. Protein P22 C2 repressor, DNA-binding domain [47426] (1 species)

7. Species Salmonella bacteriophage P22 [TaxId:10754] [47427] (2 PDB entries)
   contains a short additional helix at C-terminus

8. Domain d2r1jl1: 2r1j L:3-68 [151525]
   automatically matched to d1adra_

Details for d2r1jl1

PDB Entry: 2r1j, 1.53 Å

PDB Description: crystal structure of the p22 c2 repressor protein in complex with the synthetic operator 9t

PDB Compounds: (L:) Repressor protein C2

SCOP Domain Sequences for d2r1jl1:

Sequence; same for both SEQRES and ATOM records:

>d2r1jl1 a.35.1.2 (L:3-68) P22 C2 repressor, DNA-binding domain {Salmonella bacteriophage P22 [TaxId: 10754]}
tqlmgerirarrkklkirqaalgkmvgvsnvaisqwersetepngenllalskalqcspd
yllkgd

Timeline for d2r1jl1:

• d2r1jl1 is new in SCOP 1.75
  
• d2r1jl1 is called d2r1jl_ in SCOPe 2.01
  
• d2r1jl1 appears in the current release, SCOPe 2.08, called d2r1jl_