Lineage for d3mba__ (3mba -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies) Superfamily a.1.1: Globin-like [46458] (3 families) 
Family a.1.1.2: Globins [46463] (16 proteins) Protein Myoglobin [46469] (9 species) 
Species Sea hare (Aplysia limacina) [TaxId:6502] [46471] (7 PDB entries) 
Domain d3mba__: 3mba - [15152]
Details for d3mba__
PDB Entry: 3mba (more details), 2 Å
PDB Description: aplysia limacina myoglobin. crystallographic analysis at 1.6 angstroms resolution
SCOP Domain Sequences for d3mba__:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mba__ a.1.1.2 (-) Myoglobin {Sea hare (Aplysia limacina)}
slsaaeadlagkswapvfanknangldflvalfekfpdsanffadfkgksvadikaspkl
rdvssriftrlnefvnnaanagkmsamlsqfakehvgfgvgsaqfenvrsmfpgfvasva
appagadaawtklfgliidalkaaga
SCOP Domain Coordinates for d3mba__:
Click to download the PDB-style file with coordinates for d3mba__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3mba__:
- d3mba__ appears in SCOP 1.57
- d3mba__ appears in the current release, SCOPe 2.08, called d3mbaa_
View in 3D