Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds) |
Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily) 2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology |
Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles) |
Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (10 proteins) |
Protein Glutaryl-CoA dehydrogenase GCDH [111293] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [111294] (3 PDB entries) Uniprot Q92947 |
Domain d2r0na2: 2r0n A:3-238 [151507] Other proteins in same PDB: d2r0na1 automated match to d1sira2 complexed with fad, tgc; mutant |
PDB Entry: 2r0n (more details), 2.3 Å
SCOPe Domain Sequences for d2r0na2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r0na2 e.6.1.1 (A:3-238) Glutaryl-CoA dehydrogenase GCDH {Human (Homo sapiens) [TaxId: 9606]} efdwqdplvleeqlttdeilirdtfrtycqerlmprillanrnevfhreiisemgelgvl gptikgygcagvssvaygllarelervdsgyrsamsvqsslvmhpiyaygseeqrqkylp qlakgellgcfgltepnsgsdpssmetrahynssnksytlngtktwitnspmadlfvvwa rcedgcirgfllekgmrglsapriqgkfslrasatgmiimdgvevpeenvlpgass
Timeline for d2r0na2: