Lineage for d2fala_ (2fal A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2687850Protein Myoglobin [46469] (11 species)
  7. 2688012Species Slug sea hare (Aplysia limacina) [TaxId:6502] [46471] (7 PDB entries)
  8. 2688014Domain d2fala_: 2fal A: [15150]
    complexed with cyn, hem

Details for d2fala_

PDB Entry: 2fal (more details), 1.8 Å

PDB Description: x-ray crystal structure of ferric aplysia limacina myoglobin in different liganded states
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d2fala_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fala_ a.1.1.2 (A:) Myoglobin {Slug sea hare (Aplysia limacina) [TaxId: 6502]}
slsaaeadlagkswapvfanknangldflvalfekfpdsanffadfkgksvadikaspkl
rdvssriftrlnefvnnaanagkmsamlsqfakehvgfgvgsaqfenvrsmfpgfvasva
appagadaawtklfgliidalkaaga

SCOPe Domain Coordinates for d2fala_:

Click to download the PDB-style file with coordinates for d2fala_.
(The format of our PDB-style files is described here.)

Timeline for d2fala_: