SCOPe 2.01: Domain d2qypb_: 2qyp B:

Lineage for d2qypb_ (2qyp B:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.64: Saposin-like [47861] (2 superfamilies)
   5 helices; folded leaf, closed

4. Superfamily a.64.1: Saposin [47862] (5 families)
   Lipid-binding can promote conformational changes and oligomerisation in some members

5. Family a.64.1.1: NKL-like [47863] (3 proteins)

6. Protein Saposin C [89077] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89078] (10 PDB entries)

8. Domain d2qypb_: 2qyp B: [151478]
   automated match to d1m12a_

Details for d2qypb_

PDB Entry: 2qyp, 2.45 Å

PDB Description: Orthorhombic Crystal Structure of Human Saposin C Dimer in Open Conformation

PDB Compounds: (B:) Proactivator polypeptide

SCOPe Domain Sequences for d2qypb_:

Sequence; same for both SEQRES and ATOM records:

>d2qypb_ a.64.1.1 (B:) Saposin C {Human (Homo sapiens) [TaxId: 9606]}
ayvsdvycevceflvkevtklidnnktekeildafdkmcsklpkslseecqevvdtygss
ilsilleevspelvcsmlhlc

Timeline for d2qypb_:

• d2qypb_ first appeared in SCOP 1.75, called d2qypb1
  
• d2qypb_ appears in SCOPe 2.02
  
• d2qypb_ appears in the current release, SCOPe 2.08, called d2qypb2