SCOP 1.75: Domain d2qypb1: 2qyp B:1-78

Lineage for d2qypb1 (2qyp B:1-78)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.64: Saposin-like [47861] (2 superfamilies)
   5 helices; folded leaf, closed

4. Superfamily a.64.1: Saposin [47862] (4 families)
   Lipid-binding can promote conformational changes and oligomerisation in some members

5. Family a.64.1.1: NKL-like [47863] (3 proteins)

6. Protein Saposin C [89077] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89078] (5 PDB entries)

8. Domain d2qypb1: 2qyp B:1-78 [151478]
   automatically matched to d1m12a_

Details for d2qypb1

PDB Entry: 2qyp, 2.45 Å

PDB Description: Orthorhombic Crystal Structure of Human Saposin C Dimer in Open Conformation

PDB Compounds: (B:) Proactivator polypeptide

SCOP Domain Sequences for d2qypb1:

Sequence; same for both SEQRES and ATOM records:

>d2qypb1 a.64.1.1 (B:1-78) Saposin C {Human (Homo sapiens) [TaxId: 9606]}
sdvycevceflvkevtklidnnktekeildafdkmcsklpkslseecqevvdtygssils
illeevspelvcsmlhlc

Timeline for d2qypb1:

• d2qypb1 is new in SCOP 1.75
  
• d2qypb1 is called d2qypb_ in SCOPe 2.01
  
• d2qypb1 appears in the current release, SCOPe 2.08, called d2qypb2