![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins) |
![]() | Protein Complement C1R protease, catalytic domain [74976] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [74977] (4 PDB entries) |
![]() | Domain d2qy0b1: 2qy0 B:447-686 [151467] automatically matched to d1md8a1 complexed with gol |
PDB Entry: 2qy0 (more details), 2.6 Å
SCOPe Domain Sequences for d2qy0b1:
Sequence, based on SEQRES records: (download)
>d2qy0b1 b.47.1.2 (B:447-686) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} iiggqkakmgnfpwqvftnihgrgggallgdrwiltaahtlypkeheaqsnasldvflgh tnveelmklgnhpirrvsvhpdyrqdesynfegdiallelensvtlgpnllpiclpdndt fydlglmgyvsgfgvmeekiahdlrfvrlpvanpqacenwlrgknrmdvfsqnmfcaghp slkqdacqgdsggvfavrdpntdrwvatgivswgigcsrgygfytkvlnyvdwikkemee
>d2qy0b1 b.47.1.2 (B:447-686) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} iiggqkakmgnfpwqvftnihgrgggallgdrwiltaahtlypkeheasldvflghtnve elmklgnhpirrvsvhpdyrqdesynfegdiallelensvtlgpnllpiclpdndtfydl glmgyvsgfgvmeekiahdlrfvrlpvanpqacenwlrgknrmdvfsqnmfcaghpslkq dacqgdsggvfavrdpntdrwvatgivswgigcsrgygfytkvlnyvdwikkemee
Timeline for d2qy0b1: