Lineage for d2qy0b1 (2qy0 B:447-686)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 952974Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 952975Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 953177Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 953478Protein Complement C1R protease, catalytic domain [74976] (1 species)
  7. 953479Species Human (Homo sapiens) [TaxId:9606] [74977] (4 PDB entries)
  8. 953480Domain d2qy0b1: 2qy0 B:447-686 [151467]
    automatically matched to d1md8a1
    complexed with gol

Details for d2qy0b1

PDB Entry: 2qy0 (more details), 2.6 Å

PDB Description: Active dimeric structure of the catalytic domain of C1r reveals enzyme-product like contacts
PDB Compounds: (B:) Complement C1r subcomponent

SCOPe Domain Sequences for d2qy0b1:

Sequence, based on SEQRES records: (download)

>d2qy0b1 b.47.1.2 (B:447-686) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
iiggqkakmgnfpwqvftnihgrgggallgdrwiltaahtlypkeheaqsnasldvflgh
tnveelmklgnhpirrvsvhpdyrqdesynfegdiallelensvtlgpnllpiclpdndt
fydlglmgyvsgfgvmeekiahdlrfvrlpvanpqacenwlrgknrmdvfsqnmfcaghp
slkqdacqgdsggvfavrdpntdrwvatgivswgigcsrgygfytkvlnyvdwikkemee

Sequence, based on observed residues (ATOM records): (download)

>d2qy0b1 b.47.1.2 (B:447-686) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
iiggqkakmgnfpwqvftnihgrgggallgdrwiltaahtlypkeheasldvflghtnve
elmklgnhpirrvsvhpdyrqdesynfegdiallelensvtlgpnllpiclpdndtfydl
glmgyvsgfgvmeekiahdlrfvrlpvanpqacenwlrgknrmdvfsqnmfcaghpslkq
dacqgdsggvfavrdpntdrwvatgivswgigcsrgygfytkvlnyvdwikkemee

SCOPe Domain Coordinates for d2qy0b1:

Click to download the PDB-style file with coordinates for d2qy0b1.
(The format of our PDB-style files is described here.)

Timeline for d2qy0b1: