Lineage for d2qx1b2 (2qx1 B:175-317B)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2916987Family c.95.1.2: Chalcone synthase-like [53914] (15 proteins)
  6. 2917122Protein Ketoacyl-ACP synthase III (FabH) [53912] (5 species)
  7. 2917174Species Mycobacterium tuberculosis [TaxId:1773] [64196] (12 PDB entries)
  8. 2917218Domain d2qx1b2: 2qx1 B:175-317B [151446]
    automated match to d1hzpa2
    complexed with coa, d1t

Details for d2qx1b2

PDB Entry: 2qx1 (more details), 2.6 Å

PDB Description: crystal structure of the complex between mycobacterium tuberculosis beta-ketoacyl-acyl carrier protein synthase iii (fabh) and decyl-coa disulfide
PDB Compounds: (B:) beta-ketoacyl-acp synthase III

SCOPe Domain Sequences for d2qx1b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qx1b2 c.95.1.2 (B:175-317B) Ketoacyl-ACP synthase III (FabH) {Mycobacterium tuberculosis [TaxId: 1773]}
gptvagsdgeqadairqdidwitfaqnpsgprpfvrlegpavfrwaafkmgdvgrramda
agvrpdqidvfvphqansrinellvknlqlrpdavvandiehtgntsaasiplamaellt
tgaakpgdlalligygaglsyaaqvvrmpk

SCOPe Domain Coordinates for d2qx1b2:

Click to download the PDB-style file with coordinates for d2qx1b2.
(The format of our PDB-style files is described here.)

Timeline for d2qx1b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qx1b1